DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr58b and Gr36b

DIOPT Version :9

Sequence 1:NP_523808.2 Gene:Gr58b / 37502 FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:409 Identity:75/409 - (18%)
Similarity:159/409 - (38%) Gaps:99/409 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TLRIRSCRKCLRLEKVSRTYTIYSFFVGIFLFLNLYFMVPRIMEDG-----YMKYNIVLQWNFFV 85
            |.|:...|:|          |||:|...||:.:.:.:   .....|     :...|.:.::...:
  Fly    30 TGRVFKSRRC----------TIYAFMANIFILITIIY---NFTAHGDTNLLFQSANKLHEYVIII 81

  Fly    86 MLFLRAIAVVSCYGTLWLKRHKIIQLYKYSLIYWKRFGHITRAIVDKKELLDLQESLARIMIRKI 150
            |..|:.:|.:......||:|.:::||.|          .:.|..:...:|        :.|||..
  Fly    82 MSGLKIVAGLITVLNRWLQRGQMMQLVK----------DVIRLYMINPQL--------KSMIRWG 128

  Fly   151 ILLYSAFLCSTVLQYQL-LSV-------------INPQIFLAFCARLTHFLHFLCVKMGFFGVLV 201
            ||| .||:...:...|: |||             :..::.::|...|....|||        |::
  Fly   129 ILL-KAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAISQHFL--------VIL 184

  Fly   202 LLNHQFLVIHLAINALHGRKARKKWKALRSVAAM--------HLKTL--------RLARRIFDMF 250
            |:..|:.:::..:..:.....|..:..||:.|.|        .|:.:        .:..::.::|
  Fly   185 LIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVF 249

  Fly   251 DIANATVFINMFMTAIN---ILYHAVQYSNSSIKSNGWGILFGNGLIVFNFWGTMALMEMLDSVV 312
            .:.....:...:::.:.   :.|...:|...::|.:.     ...:||.    .:..:..||::|
  Fly   250 GMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSA-----KTSIIVC----ILITLFYLDALV 305

  Fly   313 TSCNNTGQQLRQLSDL-----------PKVGPKMQRELDVFTMQLRQNRLVYKICGIVELDKPAC 366
             :|||..:.|....|.           ..:..:::...:...:||.:|.|...:.|:..:.:.:.
  Fly   306 -NCNNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQLQLARNPLKINVMGMFPITRGST 369

  Fly   367 LSYIGSILSNVIILMQFDL 385
            .:...|::.|.|.|:|||:
  Fly   370 AAMCASVIVNSIFLIQFDM 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 74/407 (18%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 75/409 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.