DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr58b and Gr36c

DIOPT Version :9

Sequence 1:NP_523808.2 Gene:Gr58b / 37502 FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster


Alignment Length:428 Identity:70/428 - (16%)
Similarity:166/428 - (38%) Gaps:98/428 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VMNVVYYHSVVFALMS-----TTLRIRSCRKCLRLEKVSRTYTIYSFFV----GIFLFLNLYFMV 64
            ::..|||:.:...|.:     .|.|:.: :|...|..::....|::.::    |....:|..|..
  Fly     7 LLGAVYYYGLFIGLSNFEFDWNTGRVFT-KKWSTLYAIALDSCIFALYIYHWTGNTNIVNAIFGR 70

  Fly    65 PRIMEDGYMKYNIVLQWNFFVMLFLRAIAVVSCYGTL---WLKR-------HKIIQLY--KYSLI 117
            ..::.:             :|:..|..:.:|:...||   |.:|       .|::::|  :..:.
  Fly    71 ANMLHE-------------YVVAILTGLRIVTGLFTLILRWYQRCKMMDLASKVVRMYVARPQVR 122

  Fly   118 YWKRFGHITRAIVDKKELLDLQESLARIMIRKII-LLYSAFLCSTVLQYQLLSVINPQIFLAFCA 181
            ...|:|.:|:.|..     .:.:.|...|:...: .:.|.|.....|||.:..::|       .|
  Fly   123 RMSRWGILTKFIFG-----SITDGLQMAMVLSAMGSVDSQFYLGLGLQYWMFVILN-------MA 175

  Fly   182 RLTHFLHFLCVKMGFFGVLVLLNHQFLVI-----HLAINALHGRKARKKWKAL----RSVAAMHL 237
            .:...:..|.|:..|    .|:|.:...:     .|.::..|......|..:|    .::|.:..
  Fly   176 MMQQHMIMLFVRTQF----QLINTELRQVIDEAKDLLLSPRHQGVFMTKCCSLADQIENIARIQS 236

  Fly   238 KTLRLARRIFDMFDIANATVFINMFMTAINILYHAVQ-----YSNSS------IKSNGWGILFG- 290
            :...:..::.::|.|..|..:...:::::...|.|..     |.|.|      |.:..|...:. 
  Fly   237 QLQTIMNQMEEVFGIQGAMTYGGYYLSSVGTCYLAYSILKHGYENLSMTLSTVILAYSWCFFYYL 301

  Fly   291 NGLIVF--------NFWGTMALMEMLDSVVTSCNNTGQQLRQLSDLPKVGPKMQRELDVFTMQLR 347
            :|::..        ::|      |||           |.|.:.:....:..:::...:...:||.
  Fly   302 DGMLNLSVMLHVQDDYW------EML-----------QILGKRTIFVGLDVRLEEAFENLNLQLI 349

  Fly   348 QNRLVYKICGIVELDKPACLSYIGSILSNVIILMQFDL 385
            :|.|...:..:.::.:...::..|:::::.|.|:|:|:
  Fly   350 RNPLKITVVKLYDVTRSNTMAMFGNLITHSIFLIQYDI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 69/423 (16%)
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 70/427 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.