powered by:
Protein Alignment KCND1 and rpl3702
DIOPT Version :9
Sequence 1: | XP_024308146.1 |
Gene: | KCND1 / 3750 |
HGNCID: | 6237 |
Length: | 675 |
Species: | Homo sapiens |
Sequence 2: | NP_588350.1 |
Gene: | rpl3702 / 2538715 |
PomBaseID: | SPCC1223.05c |
Length: | 91 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 35 |
Identity: | 8/35 - (22%) |
Similarity: | 16/35 - (45%) |
Gaps: | 0/35 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 412 SRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAF 446
:|.|:...:|.:||.....|::.::.......|.|
pombe 44 TRSYNWGAKAKRRRTTGTGRMSYLKKVHRSFKNGF 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2126 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.