DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCND1 and rpl3702

DIOPT Version :9

Sequence 1:XP_024308146.1 Gene:KCND1 / 3750 HGNCID:6237 Length:675 Species:Homo sapiens
Sequence 2:NP_588350.1 Gene:rpl3702 / 2538715 PomBaseID:SPCC1223.05c Length:91 Species:Schizosaccharomyces pombe


Alignment Length:35 Identity:8/35 - (22%)
Similarity:16/35 - (45%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   412 SRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAF 446
            :|.|:...:|.:||.....|::.::.......|.|
pombe    44 TRSYNWGAKAKRRRTTGTGRMSYLKKVHRSFKNGF 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCND1XP_024308146.1 Shal-type 3..28 CDD:288455
BTB_2 42..131 CDD:308049
Ion_trans 185..417 CDD:306908 2/4 (50%)
DUF3399 447..578 CDD:314709 8/35 (23%)
rpl3702NP_588350.1 PTZ00073 1..81 CDD:240257 8/35 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.