DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk9 and ASIC4

DIOPT Version :9

Sequence 1:NP_611622.2 Gene:ppk9 / 37498 FlyBaseID:FBgn0085398 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_061144.4 Gene:ASIC4 / 55515 HGNCID:21263 Length:539 Species:Homo sapiens


Alignment Length:490 Identity:95/490 - (19%)
Similarity:169/490 - (34%) Gaps:126/490 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 FLQGSSIHGFIYLAKLGLSFVERVLWLAFICVALFSIISLSKRTWHRFQTSPMVISMDRNKLVWN 218
            |...|::||.......|...:.|.||...:..:|.:.:..:......:.|.|.:::||.......
Human    45 FASTSTLHGLGRACGPGPHGLRRTLWALALLTSLAAFLYQAAGLARGYLTRPHLVAMDPAAPAPV 109

  Fly   219 TSFPSLTVCPHKRIDELKVEEYILAHPDQF--LSEEDQEDFRDFIVKLASLTYDNLETLP-LNKS 280
            ..||::|:|...|.....:.:..:.|....  |..:|::..|     .|.|.|...:.:. ||::
Human   110 AGFPAVTLCNINRFRHSALSDADIFHLANLTGLPPKDRDGHR-----AAGLRYPEPDMVDILNRT 169

  Fly   281 YGIPSTKYLELLYELKWAFEPEISSGAAVKMFIYETQTEFGICHSVN-----SMVARYNSF---- 336
                ..:..::|....::.....:|..:|   :|   |.:|.|::.|     |:.:|....    
Human   170 ----GHQLADMLKSCNFSGHHCSASNFSV---VY---TRYGKCYTFNADPRSSLPSRAGGMGSGL 224

  Fly   337 ---------DY---WRSGDWSLMDHGDRVTVHPLDGEIYAQIINLSTAYDVYFH--GAGDVP--- 384
                     :|   ||..:.:..:.|.||.:|             |.....|.|  |.|..|   
Human   225 EIMLDIQQEEYLPIWRETNETSFEAGIRVQIH-------------SQEEPPYIHQLGFGVSPGFQ 276

  Fly   385 ---SISKQRYTFPESDYTTVELIALEIFTNEEARATKQRSCRFNYEAE--EMMTVPIYSFGLCLS 444
               |..:||.|:....:                     .:||...|..  |:.....||...|..
Human   277 TFVSCQEQRLTYLPQPW---------------------GNCRAESELREPELQGYSAYSVSACRL 320

  Fly   445 ECRMFFALRVCG------------CVPHFYRNRCGYNHIFGTQMRNGRRLPV-----CGLEGIGC 492
            .|.....|:.|.            |.|:.| ..|. :|...: :..|...|.     |.|...| 
Human   321 RCEKEAVLQRCHCRMVHMPGNETICPPNIY-IECA-DHTLDS-LGGGPEGPCFCPTPCNLTRYG- 381

  Fly   493 LVKIKREIISLKSDKYKINCNCLANCDDSNFFVQSY-RSRVW----FLGANLQWGILEHPKMQLR 552
                 :||..::          :.|...:.:..:.| |:..:    ||..::.:..|....|:.|
Human   382 -----KEISMVR----------IPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQR 431

  Fly   553 REVLFSFADVLVYIGGLVGFFLGCSALSFTEIIYY 587
              ..:..:.:|..:||.:|.|:|.|.|:..||:.|
Human   432 --AAYGLSALLGDLGGQMGLFIGASILTLLEILDY 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk9NP_611622.2 ASC 154..587 CDD:279230 94/488 (19%)
ASIC4NP_061144.4 ASC 40..488 CDD:413546 95/490 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152200
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.