DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk9 and ppk27

DIOPT Version :9

Sequence 1:NP_611622.2 Gene:ppk9 / 37498 FlyBaseID:FBgn0085398 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_647826.2 Gene:ppk27 / 38440 FlyBaseID:FBgn0035458 Length:422 Species:Drosophila melanogaster


Alignment Length:481 Identity:100/481 - (20%)
Similarity:183/481 - (38%) Gaps:121/481 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IIEFLQGSSIHGFIYLAKLGLSFVERVLWLAFI-------CVALFSIISLSKRTWHRFQTSPMVI 208
            ::|:.:.:|::||..|..:....::|:.|..||       ..|:||::.       .|.:...:.
  Fly    12 VVEYFRKTSLNGFGLLYFIRKRRIQRIFWFLFISFGILFASYAVFSMVL-------EFLSYSTIA 69

  Fly   209 SMDRNKLVWN-TSFPSLTVCPHKRIDELKVEEYILAHPDQFLSEED----QEDFRDFIVKLASLT 268
            .:...|::.: ..||.|.:|          ..|..::.:...|..|    |....|:.:...||.
  Fly    70 DLSELKVLEDEIHFPELKIC----------SGYKFSYRNMLASAHDLVSSQNKSLDYWLNKLSLL 124

  Fly   269 YDNLETLPLNKSYGIPSTKYLELLYELK------WAFEPEISS-----------GAAVKMFIYET 316
            ....:.|.: |:..:..   |..|.::|      .|..|...|           ...:|:|..:.
  Fly   125 SGYFDALSV-KAENVDD---LNSLLDIKNISSFLLALTPACESLILKCKLNNIPANCLKLFTLKA 185

  Fly   317 QTEFGICHSVNSMVARYNSFDYWRSGDWSLMDHGDRVTVHPLDGEIYAQIINLSTAYDVYFHGAG 381
            ..:...|...||.:          :|:.:|.....::..:||:|.:        ..:.::     
  Fly   186 YNDGNCCVLRNSNL----------TGELTLFMDSSQIDEYPLNGNL--------PGFSLH----- 227

  Fly   382 DVPSISKQRYTFPESDYTTVELIALEIFTNEEAR--ATKQRSCRFNYEAEEMMTVPIYSFGLCLS 444
             ||| .:.|.:....:...||:..:|:..|.:..  |.::|:|.|:.|.|        |...||.
  Fly   228 -VPS-WQGRVSINPGEMAAVEIEVMELQGNSQLNEYAVEKRACYFSQEGE--------SREKCLH 282

  Fly   445 ECRMFFALRVCGCVPH---FYRNRCGYNHIFGTQMRNGRRLPVCGLEGIGCLVKIKREIISLKSD 506
            |||:...|..|.|||:   |...:.||                |.||.|.||..::|.....:..
  Fly   283 ECRIKATLINCQCVPYPFEFRTQKFGY----------------CTLENIRCLQLVERNWSPAQCP 331

  Fly   507 KYKINCNCLANCDDSNFFVQSYRSRVWFLG------ANLQWGILEHPKMQLRREVLFSFADVLVY 565
            :      ||..|  :..|   ||.....||      :.|.:......:.:.:..:|:.:..:|..
  Fly   332 Q------CLPLC--NQLF---YRLNKQILGHLHPWRSELNFKFKTPHRQRYKTNILYHWYQMLSN 385

  Fly   566 IGGLVGFFLGCSALSFTEIIYYFTAR 591
            :||::|..:|||.:|..|:||:...|
  Fly   386 VGGVLGICIGCSFISGFELIYFLVFR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk9NP_611622.2 ASC 154..587 CDD:279230 97/472 (21%)
ppk27NP_647826.2 ASC 15..407 CDD:279230 97/472 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.