DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk9 and ppk17

DIOPT Version :9

Sequence 1:NP_611622.2 Gene:ppk9 / 37498 FlyBaseID:FBgn0085398 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster


Alignment Length:424 Identity:82/424 - (19%)
Similarity:138/424 - (32%) Gaps:142/424 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 PSLTVC---PHKRIDELKVEEYILAHP----------------DQFLSEEDQEDFRDFIVKLASL 267
            ||:|:|   |:|.....::......||                |:|....               
  Fly    62 PSVTICREPPYKEEVLTRLSGGACPHPKYATCWMKYPFGEISLDEFFENS--------------- 111

  Fly   268 TYDNLETLPLNKSYGIPSTK-----------YLELLYELKWAFEPEISSGAAVKMFIYETQTEFG 321
            |:|:.:|...   ||:...|           |:...|.|:    |:.|:....|...|....|  
  Fly   112 THDSGDTFVF---YGLNEDKNNVVMNSSLHFYMGRCYTLR----PKESAKRVSKAVGYSIMLE-- 167

  Fly   322 ICHSVNSMVARYNSFDYWRSGDWSLMDHGDRVTVHPLDGEIYAQIINLSTAYDVYFHGAGDVPSI 386
              ||:  :....:..|....| |.:..|..:        |.:.: ||:.        |:|.|   
  Fly   168 --HSM--LTTSVSDVDTGSVG-WHVFIHDKK--------ENFTE-INMK--------GSGRV--- 207

  Fly   387 SKQRYTFPESDYTTVELIALEIFTNEEARATKQRSCRFNYEAEEMMTVPIYSFGLCLSECRMFFA 451
               .|.|              :..|||.....|.....|.:..|.          ..|:...:..
  Fly   208 ---EYVF--------------VGVNEEIEIKLQTQYFSNVQTREE----------ACSDDENYSD 245

  Fly   452 LRVCGCVPHFYRNRCGYNHIFGTQMRNGRRLPVCGLEGIGCLVKIKREIISLKSDKYK----INC 512
            |: ||       .:|.:..:......:|..:.....|.....:.: |::||...|.|:    .:|
  Fly   246 LK-CG-------EQCIWQDLADNMQCSGPWMHEIASEPCNDSLSM-RKLISDYKDVYENEDDFDC 301

  Fly   513 NCLANCDDSNF--FVQSY--------RSRVW-FLGANLQWGILEHPKMQLRREVLFSFADVLVYI 566
            :|:..|....:  |:|:.        |:::: :....|...|.|.|.....:.:    |||    
  Fly   302 DCVQPCQSRIYTTFIQNRKAFNQPEPRTQIYIYYTTKLISMIEERPSYDTTQFI----ADV---- 358

  Fly   567 GGLVGFFLGCSALSFTEII----YYFTARFVRRM 596
            ||.:||.||.|.|....|:    .:|...|::||
  Fly   359 GGSLGFLLGLSVLGLIGILEHMMLFFCGGFIKRM 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk9NP_611622.2 ASC 154..587 CDD:279230 78/413 (19%)
ppk17NP_001285988.1 ASC 11..358 CDD:295594 67/384 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456765
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.