DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk9 and Scnn1b

DIOPT Version :9

Sequence 1:NP_611622.2 Gene:ppk9 / 37498 FlyBaseID:FBgn0085398 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_036780.1 Gene:Scnn1b / 24767 RGDID:3640 Length:638 Species:Rattus norvegicus


Alignment Length:188 Identity:41/188 - (21%)
Similarity:65/188 - (34%) Gaps:57/188 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 YSFGLCLSECRMFFALRVCGCVPHFYRNRCGYNHIFGTQMRNGRRLPVCGLEGIGCLVKIKREII 501
            ||...||..|.....:..|.|..:.|....|..:.      |.|..|    :...|.:.::..::
  Rat   379 YSIQACLHSCFQDHMIHNCSCGHYLYPLPAGEKYC------NNRDFP----DWAYCYLSLQMSVV 433

  Fly   502 SLKSDKYKINCNCLANCDDSNFFVQSYRSRV----WFLGANLQWGILEHPKMQLR---------- 552
            ..::        ||:.|.:|....| |:..:    |...|:..|  :.|...|.|          
  Rat   434 QRET--------CLSMCKESCNDTQ-YKMTISMADWPSEASEDW--ILHVLSQERDQSSNITLSR 487

  Fly   553 ---------------REVLFSFADVLVY----IGGLVGFFLGCSAL---SFTEIIYYF 588
                           |.:..|.|:.:|:    :||..||::|.|.|   .|.|||..|
  Rat   488 KGIVKLNIYFQEFNYRTIEESPANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDF 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk9NP_611622.2 ASC 154..587 CDD:279230 40/185 (22%)
Scnn1bNP_036780.1 ENaC 21..621 CDD:273304 41/188 (22%)
deg-1 29..538 CDD:273309 36/179 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 598..620
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345649
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.