DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk9 and egas-3

DIOPT Version :9

Sequence 1:NP_611622.2 Gene:ppk9 / 37498 FlyBaseID:FBgn0085398 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_507638.2 Gene:egas-3 / 190557 WormBaseID:WBGene00013480 Length:921 Species:Caenorhabditis elegans


Alignment Length:258 Identity:47/258 - (18%)
Similarity:90/258 - (34%) Gaps:61/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 GDVPSISKQRYTFPESDYTT-VELIALEIFTNEEARATKQRSCRFNYEAEEMMTVPIY------- 437
            |.:.:..|.|    :.:|.. .:..|:.:|.:.........|.|:|.:.....|:.|:       
 Worm   672 GGIQAFMKTR----QDEYAPWYDTAAINVFIHNRDDYVFSESVRYNAQPNAQSTINIFMTRYTRL 732

  Fly   438 --SFGLCL---SECRMFF---ALRVCGCVPHFYRNR----CGYNHIFGTQMRNGRRLPVCGLEGI 490
              ::|.|:   ||.:.::   |....||:...|::|    |........|..|...   |.|...
 Worm   733 GGNYGKCIKKPSEVKNYYYPGAYTTDGCLRTCYQDRMKEECNCMDPRYPQAPNSTS---CQLSER 794

  Fly   491 GCLVKIKREIISLKSDKYKINCNCLANCDDSNFFVQSYRSRVWFLG-----------ANLQWGIL 544
            .|:.:...   :........:|.|...|.:..:.|.  .|:..|:.           |..|    
 Worm   795 SCVTEASE---AAGDPSTWSSCVCPLPCSNQEYSVT--WSKANFVNLPITCEKSSDVATCQ---- 850

  Fly   545 EHPKMQLRREVLFSFADVLVY--------------IGGLVGFFLGCSALSFTEIIYYFTARFV 593
            :..|.||...::....|..:|              :||.:|..:|.:.::|.|:::.|...|:
 Worm   851 KQYKDQLMVSIILPQLDFKIYAETPAMDFNKFLSQLGGQLGVLMGINVVTFIEVVFLFFGMFM 913

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk9NP_611622.2 ASC 154..587 CDD:279230 45/250 (18%)
egas-3NP_507638.2 ASC <649..907 CDD:279230 45/250 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.