DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk9 and mec-4

DIOPT Version :9

Sequence 1:NP_611622.2 Gene:ppk9 / 37498 FlyBaseID:FBgn0085398 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_510712.2 Gene:mec-4 / 181728 WormBaseID:WBGene00003168 Length:768 Species:Caenorhabditis elegans


Alignment Length:390 Identity:78/390 - (20%)
Similarity:119/390 - (30%) Gaps:145/390 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 LASLTYDNLETLPLNKSYGIPSTKYLELLYELKWAFEPEISSGAAVKM---FIYETQTEFGICHS 325
            :|:|:..:.|.|         ||...||:::..:       :|.|..:   |:......||.|.:
 Worm   428 MATLSMQDRERL---------STTKRELVHKCSF-------NGKACDIEADFLTHIDPAFGSCFT 476

  Fly   326 VN------------------SMVARYNSFDYWRSGDWSLMDHGDRVTVHPLDGEIYAQIINLS-- 370
            .|                  .|:...|:.||..:.:.:    |.|:|:|..:...:......|  
 Worm   477 FNHNRTVNLTSIRAGPMYGLRMLVYVNASDYMPTTEAT----GVRLTIHDKEDFPFPDTFGYSAP 537

  Fly   371 TAYDVYFHGA------------GDVPSISKQRYTFPESDYTTVELIALEIFTNEEARATKQRSCR 423
            |.| |...|.            ||.....|      .|||         |::|.|          
 Worm   538 TGY-VSSFGLRLRKMSRLPAPYGDCVPDGK------TSDY---------IYSNYE---------- 576

  Fly   424 FNYEAEEMMTVPIYSFGLCLSECRMFFALRVCGC------VPHFYRNRCGYNHIFGTQMRNGRRL 482
                         ||...|...|.....|:.|.|      ||...|: |........:..:.|..
 Worm   577 -------------YSVEGCYRSCFQQLVLKECRCGDPRFPVPENARH-CDAADPIARKCLDARMN 627

  Fly   483 PVCGLEGIGCLVKIKREIISLKSDKYKINCNCLANCDDSNFFVQSYRSRVW-FLGANLQWGIL-- 544
            .:.||.|                   ...|.|...|..|.:.| :|....| .|...:|.|..  
 Worm   628 DLGGLHG-------------------SFRCRCQQPCRQSIYSV-TYSPAKWPSLSLQIQLGSCNG 672

  Fly   545 ------EHPK----------MQLRREVL-----FSFADVLVYIGGLVGFFLGCSALSFTEIIYYF 588
                  :|.|          .||..|:|     :.|.::|...||.:|.:.|.|.|:..|.::.|
 Worm   673 TAVECNKHYKENGAMVEVFYEQLNFEMLTESEAYGFVNLLADFGGQLGLWCGISFLTCCEFVFLF 737

  Fly   589  588
             Worm   738  737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk9NP_611622.2 ASC 154..587 CDD:279230 77/387 (20%)
mec-4NP_510712.2 deg-1 86..736 CDD:273309 77/387 (20%)
ASC 87..>172 CDD:279230
ASC <428..739 CDD:295594 78/390 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.