DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk9 and del-10

DIOPT Version :9

Sequence 1:NP_611622.2 Gene:ppk9 / 37498 FlyBaseID:FBgn0085398 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_495302.3 Gene:del-10 / 174069 WormBaseID:WBGene00020897 Length:1069 Species:Caenorhabditis elegans


Alignment Length:67 Identity:20/67 - (29%)
Similarity:35/67 - (52%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   524 FVQSYRSRVWFLGANLQW-GILEHPKMQLR---REVLFSFADVLVYIGGLVGFFLGCSALSFTEI 584
            ::::::....|:|.|... .|..| :|.|.   ::..:.|..:...|||.:|.|||.|.|:..||
 Worm   783 YLENFQFGNKFVGDNFAMVNIFLH-RMNLEVWSQDRTYGFWSLACDIGGALGLFLGASLLTIIEI 846

  Fly   585 IY 586
            :|
 Worm   847 VY 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk9NP_611622.2 ASC 154..587 CDD:279230 20/67 (30%)
del-10NP_495302.3 ASC 83..>419 CDD:279230
ASC <789..849 CDD:279230 20/61 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.