DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk9 and del-10

DIOPT Version :10

Sequence 1:NP_611622.2 Gene:ppk9 / 37498 FlyBaseID:FBgn0085398 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_495302.3 Gene:del-10 / 174069 WormBaseID:WBGene00020897 Length:1069 Species:Caenorhabditis elegans


Alignment Length:67 Identity:20/67 - (29%)
Similarity:35/67 - (52%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   524 FVQSYRSRVWFLGANLQW-GILEHPKMQLR---REVLFSFADVLVYIGGLVGFFLGCSALSFTEI 584
            ::::::....|:|.|... .|..| :|.|.   ::..:.|..:...|||.:|.|||.|.|:..||
 Worm   783 YLENFQFGNKFVGDNFAMVNIFLH-RMNLEVWSQDRTYGFWSLACDIGGALGLFLGASLLTIIEI 846

  Fly   585 IY 586
            :|
 Worm   847 VY 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk9NP_611622.2 ASC 154..587 CDD:459966 20/67 (30%)
del-10NP_495302.3 ASC 83..419 CDD:459966
ASC <759..849 CDD:459966 20/67 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.