powered by:
Protein Alignment ppk9 and del-10
DIOPT Version :9
Sequence 1: | NP_611622.2 |
Gene: | ppk9 / 37498 |
FlyBaseID: | FBgn0085398 |
Length: | 599 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495302.3 |
Gene: | del-10 / 174069 |
WormBaseID: | WBGene00020897 |
Length: | 1069 |
Species: | Caenorhabditis elegans |
Alignment Length: | 67 |
Identity: | 20/67 - (29%) |
Similarity: | 35/67 - (52%) |
Gaps: | 5/67 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 524 FVQSYRSRVWFLGANLQW-GILEHPKMQLR---REVLFSFADVLVYIGGLVGFFLGCSALSFTEI 584
::::::....|:|.|... .|..| :|.|. ::..:.|..:...|||.:|.|||.|.|:..||
Worm 783 YLENFQFGNKFVGDNFAMVNIFLH-RMNLEVWSQDRTYGFWSLACDIGGALGLFLGASLLTIIEI 846
Fly 585 IY 586
:|
Worm 847 VY 848
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ppk9 | NP_611622.2 |
ASC |
154..587 |
CDD:279230 |
20/67 (30%) |
del-10 | NP_495302.3 |
ASC |
83..>419 |
CDD:279230 |
|
ASC |
<789..849 |
CDD:279230 |
20/61 (33%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4294 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D303969at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.