DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk9 and scnn1gl

DIOPT Version :9

Sequence 1:NP_611622.2 Gene:ppk9 / 37498 FlyBaseID:FBgn0085398 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_017947701.2 Gene:scnn1gl / 101734161 XenbaseID:XB-GENE-22061126 Length:481 Species:Xenopus tropicalis


Alignment Length:464 Identity:90/464 - (19%)
Similarity:165/464 - (35%) Gaps:117/464 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 TWHRFQTSPMVISMDRNKLVWNTSFPSLTVC--PHKRIDELKVEEY-ILAHPDQFLSEEDQED-- 256
            |:.|:.|...|..::..:|    .||::|.|  ...|:.:|...:| .|.....|.|..:.|:  
 Frog    11 TFLRYPTQEKVTLVNSARL----PFPAITFCNLNRARMSKLNSSKYQSLTEYLSFTSGNESEEGS 71

  Fly   257 -----FRDFIVKLASLTYDNLETLPLNKSYGIPSTKYLELLYELK-----WAFEPEISSGAAVKM 311
                 .|:|...|:.||                ..:.:||.::|:     ..|..|:.:.:....
 Frog    72 ISHGRDRNFTFALSQLT----------------PQEQMELGHQLENMLISCIFHDEVCNESFFTP 120

  Fly   312 FIYETQTEFGICHSVNSMVARYNSFDYWRSGDWSLMDHGDRVTV-HPLDGEIYAQ----IINLST 371
            |:   ..:.|||::.|.  .|.....:|::.......:..:... :.|..|::.:    |.:|||
 Frog   121 FL---NPKLGICYTFNG--RRQADLQHWQNYQQEEYLNATKAGFSYGLTMELFIEQSEYISSLST 180

  Fly   372 --AYDVYFHGAGDVPSISKQRYTFPESDYTTVELIALEIFTNEEARATKQRSCRFNYEAEEMMTV 434
              ...|..||.|.:|....:....|....:.:.::.:.:...:|..::|   |....:.....|.
 Frog   181 TAGLRVVLHGQGKMPFPEDEGVNVPPGQESDIGIVKVHVKRLQEPYSSK---CSNGNDIRNFYTD 242

  Fly   435 PI---YSFGLCLSECRMFFALRVCGCVPHFYRNRCGYNHIFGTQMRNGRRLPVCGLEGIG---CL 493
            ..   ||...|...|.....::.|||            .::......|..:|:|.:....   |:
 Frog   243 VYGTDYSRETCKKSCAQAKMIKNCGC------------RMWEFPEPPGSNVPLCNISEPSVNHCV 295

  Fly   494 VKIKREIISLKSDKYKINCNCLANCDDSNF-----------------FVQSYRSRVWFLGA---- 537
                 |:...|....::.|:|...|::..|                 |.:..:||..|..|    
 Frog   296 -----EMYEYKLSHDQLKCHCPLQCEEEIFELTLSSSQWPSSMYLDSFTKRLQSRKGFQSAQSIR 355

  Fly   538 -----------NLQWGILEH-PKMQLRREVLFSFADVLVYIGGLVGFFLG---CSALSFTEIIYY 587
                       .|.:.::|. |.|||        .|:...||||||.::|   |:...|.|:|..
 Frog   356 DNVVKVVVYYQQLNYELIEEVPSMQL--------VDLFSSIGGLVGLWIGVSVCTVAEFLELILN 412

  Fly   588 FTARFVRRM 596
            .....:|::
 Frog   413 LLTFVIRQI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk9NP_611622.2 ASC 154..587 CDD:279230 89/453 (20%)
scnn1glXP_017947701.2 ASC 1..450 CDD:413546 90/464 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.