DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk9 and asic5

DIOPT Version :9

Sequence 1:NP_611622.2 Gene:ppk9 / 37498 FlyBaseID:FBgn0085398 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_017951381.2 Gene:asic5 / 100498195 XenbaseID:XB-GENE-983430 Length:852 Species:Xenopus tropicalis


Alignment Length:516 Identity:104/516 - (20%)
Similarity:189/516 - (36%) Gaps:163/516 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 FLQGSSIHGFIYLAKLG----LSFVERVLWLA----FICVALFSIIS--LSKRTWHRFQTSPMVI 208
            |...:|.||...|.:.|    .|.....:|.:    ||.:|.:.:.:  ::..:|      |...
 Frog   387 FATSTSFHGVHNLVENGGSGKNSKFRTAIWTSVVSVFIIMACWQVCTRVINYFSW------PTTT 445

  Fly   209 SMDRNKLVWNTSFPSLTVC-----PHKRIDELKVEEYI------LAHPDQFLSEE-DQEDFRDFI 261
            |:: .:.|.|..||::|.|     ..|.::.|.:..::      :.|.....|:. :.::..||:
 Frog   446 SVN-VQYVENIDFPAITFCNLNRFQTKAVNNLSIAFFLWNIVSAVLHFTSIASDPGEMQEVTDFL 509

  Fly   262 VKLASLTYDNLETLPLNKSYGIPSTKYLELLYELKWAFEPEISSGAAVKMFIYETQ--------T 318
             ||..    |.......|:||.    ||.....||.:|            |.|...        |
 Frog   510 -KLNK----NFSIKEFTKNYGF----YLNNSTLLKCSF------------FGYPCYPEDFEHIFT 553

  Fly   319 EFGICHSVN----SMVARYNS--------FD-----YWRSGDWSLMDHGDRVTVH-PL-----DG 360
            |:|.|::.|    ||..|..:        ||     :........:|.|....:| ||     ||
 Frog   554 EYGNCYTFNYNTVSMNKRITTAGRGLSVLFDIKQTEFTDEPSLGFVDAGISFVLHSPLVPPRFDG 618

  Fly   361 EIYAQIINLSTAYDVYFHGAGDVPSISKQRYTFPESDYTTVELIALEIFTNEEARATKQRSCRFN 425
                  :.|.:...::.|       :|.:|:.      |.::         |........|.:..
 Frog   619 ------LGLHSPAGMHAH-------VSMRRFK------TVIQ---------EHPWGECNPSLKLK 655

  Fly   426 YEAEEMMTVPIYSFGLCLSECRMFFALRVCGCVPHFYRNRCGYNHIFGTQMRNGRRLPVCGLEGI 490
            |.       .|||...||.||:.::....|||:|.....             ||:.   |.|:.:
 Frog   656 YH-------EIYSTYGCLQECKSYYIQNECGCIPFLLPG-------------NGKE---CDLQQL 697

  Fly   491 -GCLVKI-----KREIISLKSDKYKINCNCLANCDDSNF----------------FVQSYRSR-V 532
             .|:.:.     |.|:.|:.:    .|..|...|::::|                |:.:..|: .
 Frog   698 YNCVSRALYTIEKSELCSMGT----YNSTCPVPCEETDFPATISYSTFPSDKAAQFLSAKLSKSA 758

  Fly   533 WFLGANLQWGILEHPKMQ---LRREVLFSFADVLVYIGGLVGFFLGCSALSFTEII-YYFT 589
            .::..||.:..:::.:|.   ::::...:.:::|..|||.:|.|.|.|.::..|:: |.||
 Frog   759 LYMRNNLVYIDIKYHEMNYKIMKQQKALTASELLSNIGGQLGLFCGASMITIIEVLEYLFT 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk9NP_611622.2 ASC 154..587 CDD:279230 101/512 (20%)
asic5XP_017951381.2 Inhibitor_I29 66..129 CDD:400519
Peptidase_C1A 158..360 CDD:239068
ASC 387..816 CDD:395688 101/511 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.