DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13494 and Krtap9-21

DIOPT Version :10

Sequence 1:NP_611621.2 Gene:CG13494 / 37497 FlyBaseID:FBgn0034671 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001191959.1 Gene:Krtap9-21 / 432600 MGIID:3650331 Length:211 Species:Mus musculus


Alignment Length:83 Identity:25/83 - (30%)
Similarity:30/83 - (36%) Gaps:20/83 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CCLLIICLPLLCLCGCCGLAC--SAC-LACDEGCCGEGGGGGCCGDDGGG------------C-C 99
            ||:...|.|..|:..||...|  |.| .:|.:.||.......||.....|            | |
Mouse   128 CCISSCCQPRCCISSCCQPCCRPSCCQSSCCKPCCQPFCLNLCCQPACSGPVTCTRTCYQPTCVC 192

  Fly   100 GDG---GGCG-DCGDGCG 113
            ..|   .||| .|.:.||
Mouse   193 VPGCLSQGCGSSCCEPCG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13494NP_611621.2 None
Krtap9-21NP_001191959.1 Keratin_B2 120..>211 CDD:366678 25/83 (30%)
Keratin_B2_2 <129..161 CDD:464017 10/31 (32%)

Return to query results.
Submit another query.