DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13494 and Krtap9-20

DIOPT Version :10

Sequence 1:NP_611621.2 Gene:CG13494 / 37497 FlyBaseID:FBgn0034671 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001170955.1 Gene:Krtap9-20 / 100415785 MGIID:3652067 Length:191 Species:Mus musculus


Alignment Length:62 Identity:20/62 - (32%)
Similarity:23/62 - (37%) Gaps:16/62 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CCLLIICLPL---LCLCGCCGLACSACLACDE-----------GCCGEGGGGGCCGDDGGGC 98
            ||....|.|.   .||..||..|||..:.|..           ||..:|.|..||  :..||
Mouse   132 CCQSSCCKPCCQPFCLNLCCQPACSGPVTCTRTCYQPTCVCVPGCLSQGCGSSCC--EPCGC 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13494NP_611621.2 None
Krtap9-20NP_001170955.1 Keratin_B2 62..191 CDD:366678 18/60 (30%)

Return to query results.
Submit another query.