DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and GLC7

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_011059.3 Gene:GLC7 / 856870 SGDID:S000000935 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:184/292 - (63%)
Similarity:232/292 - (79%) Gaps:2/292 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 INLDQIIAKLKLI--GEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLN 84
            :::|.||.:|..:  .:.|..|.:...||..:||:||.:.:|||.|||:.|||.:.|||||||.:
Yeast     6 VDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYD 70

  Fly    85 LLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGF 149
            |||.||..|:||:|.||.|||||||||||:||:.||||.|.:||..|::|||||||:|||..|||
Yeast    71 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGF 135

  Fly   150 YDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLI 214
            ||||||||.:|||:||.||:||||:||||:|.|||.||||||.|.||:|||.:.||.:||:.||:
Yeast   136 YDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLL 200

  Fly   215 CDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITI 279
            ||:||||||..|:||..|:||||.|||.|||:.||.:..:.||||.|||||||||||:||||:|:
Yeast   201 CDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTL 265

  Fly   280 FSAPNYCGEFDNAGAMMCINQDLLCTFRVQRP 311
            |||||||||||||||||.:::.|||:|::.:|
Yeast   266 FSAPNYCGEFDNAGAMMSVDESLLCSFQILKP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 183/290 (63%)
MPP_superfamily 23..311 CDD:301300 183/289 (63%)
GLC7NP_011059.3 MPP_PP1_PPKL 7..297 CDD:277359 183/289 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.