DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and PPG1

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_014429.3 Gene:PPG1 / 855766 SGDID:S000005315 Length:368 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:110/291 - (37%)
Similarity:171/291 - (58%) Gaps:25/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 INLDQIIAKL---KLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYL 83
            :.||:.:.:|   :|:.|:         .:.|:|.:.:|:|:|:..::.|..|:.::||:|||:.
Yeast     1 MELDECLERLYKAQLLPEV---------TVRALCFKLKEMLVKESNVIHIQTPVTVVGDMHGQFH 56

  Fly    84 NLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYG 148
            ::|..|:..|..||:.||.||||||||..|:||:.||:.||.|||::.:|||||||...|...||
Yeast    57 DMLEIFQIGGPVPDTNYLFLGDYVDRGLYSVETIMLLIVLKLRYPSRIHLLRGNHESRQITQSYG 121

  Fly   149 FYDECKRRY--TVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPES 211
            ||.||..:|  ..::|:...|.::.|.|..||::.|||.||||||::.::.||:.|.|..|||..
Yeast   122 FYTECLNKYGGNSRVWQYLTDIFDYLVLCCIIDDEIFCVHGGLSPNVQTIDQIKIIDRFREIPHD 186

  Fly   212 GLICDILWSD-----------PDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVE 265
            |.:.|::|||           ||.....:..:.||..:|||..||..||....:|.|.|.||:..
Yeast   187 GAMADLVWSDPEENNNPTLDHPDNSGQHFQVSPRGAGYTFGRSVVEKFLRMNDMNRIYRAHQLCN 251

  Fly   266 DGYEFFAKRQLITIFSAPNYCGEFDNAGAMM 296
            :||:.:....:.|::||||||....|..:::
Yeast   252 EGYQIYFDGLVTTVWSAPNYCYRCGNKASIL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 110/291 (38%)
MPP_superfamily 23..311 CDD:301300 110/290 (38%)
PPG1NP_014429.3 MPP_PP2A_PP4_PP6 2..299 CDD:277360 110/290 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.