DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and CMP2

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_013655.1 Gene:CMP2 / 854946 SGDID:S000004521 Length:604 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:107/293 - (36%)
Similarity:153/293 - (52%) Gaps:39/293 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYPPDSVYLLLGDY 106
            ::|..:...:.:.|.|:..|:|.|:.:||||.:.|||||||.:||:.||..|.|..:.||.||||
Yeast   109 KLSAAQAARIVTLATELFSKEPNLISVPAPITVCGDIHGQYFDLLKLFEVGGDPATTSYLFLGDY 173

  Fly   107 VDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTVKLWRTFVDCYNC 171
            ||||..|.|.|..|.:||..:...|:||||||||..:..::.|.:|...:|.:.::....:.:|.
Yeast   174 VDRGSFSFECLIYLYSLKLNFNDHFWLLRGNHECKHLTSYFTFKNEMLHKYNLDIYEKCCESFNN 238

  Fly   172 LPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICDILWSDP----------DL-- 224
            |||||::.....|.|||:||.|.|:|.|..:.|..|||..||:||:||:||          ||  
Yeast   239 LPLAALMNGQYLCVHGGISPELNSLQDINNLNRFREIPSHGLMCDLLWADPIEEYDEVLDKDLTE 303

  Fly   225 -------------------RIMGWGPNE-RGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYE 269
                               |.| :.||. ||.|:.|.......||....|..|.|.|:..:.||.
Yeast   304 EDIVNSKTMVPHHGKMAPSRDM-FVPNSVRGCSYAFTYRAACHFLQETGLLSIIRAHEAQDAGYR 367

  Fly   270 FFAKRQ------LITIFSAPNYCGEFDNAGAMM 296
            .:...:      |:|:||||||...::|..|::
Yeast   368 MYKNTKTLGFPSLLTLFSAPNYLDTYNNKAAIL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 107/293 (37%)
MPP_superfamily 23..311 CDD:301300 107/293 (37%)
CMP2NP_013655.1 MPP_PP2B 95..423 CDD:277361 107/293 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.