DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and PPT1

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_011639.3 Gene:PPT1 / 853023 SGDID:S000003355 Length:513 Species:Saccharomyces cerevisiae


Alignment Length:304 Identity:104/304 - (34%)
Similarity:157/304 - (51%) Gaps:23/304 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKLLSNGSNKNKTLKFDEGINLDQIIAKLKLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLE 67
            |........||.:.:|     :.:::..|.|.|:     .:..:.:.|:.|.|..:..::|:::|
Yeast   179 KNAFKGAKIKNMSQEF-----ISKMVNDLFLKGK-----YLPKKYVAAIISHADTLFRQEPSMVE 233

  Fly    68 I------PAPINLLGDIHGQY---LNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLAL 123
            :      ...|::.||.|||:   |||.|.|...|  |...||..||:||||..|.|...|...|
Yeast   234 LENNSTPDVKISVCGDTHGQFYDVLNLFRKFGKVG--PKHTYLFNGDFVDRGSWSCEVALLFYCL 296

  Fly   124 KARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGG 188
            |..:|..|:|.|||||..::|..|||.||||.:|:.:::..|...:..||||.:|..:....|||
Yeast   297 KILHPNNFFLNRGNHESDNMNKIYGFEDECKYKYSQRIFNMFAQSFESLPLATLINNDYLVMHGG 361

  Fly   189 L-SPHLFSMQQIREIRRPIEIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRF 252
            | |....::...:.|.|..:.|..|...::||:||. ...|.||::||:.|.||.|:...||...
Yeast   362 LPSDPSATLSDFKNIDRFAQPPRDGAFMELLWADPQ-EANGMGPSQRGLGHAFGPDITDRFLRNN 425

  Fly   253 KLNLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMM 296
            ||..|.|.|::...|.:|..|.:|:|:|||||||....|.|.::
Yeast   426 KLRKIFRSHELRMGGVQFEQKGKLMTVFSAPNYCDSQGNLGGVI 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 100/285 (35%)
MPP_superfamily 23..311 CDD:301300 100/284 (35%)
PPT1NP_011639.3 PLN03088 10..>130 CDD:215568
TPR repeat 12..40 CDD:276809
TPR repeat 45..75 CDD:276809
TPR repeat 80..108 CDD:276809
MPP_PP5_C 165..508 CDD:277362 104/304 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.