DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and PPH22

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_010093.1 Gene:PPH22 / 851339 SGDID:S000002347 Length:377 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:123/292 - (42%)
Similarity:181/292 - (61%) Gaps:10/292 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NKTLKF-DEGIN-LDQIIAKLKLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLL 75
            :|.||. :..|| |||.|..|      .....:|..::..:|..|.:||..:..:..|..|:.:.
Yeast    65 SKPLKLTNTNINQLDQWIEHL------SKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTIC 123

  Fly    76 GDIHGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHEC 140
            ||:|||:.:||..|:..|..||:.||.:|||||||..|:||::.|:|:|.|||.:..:||||||.
Yeast   124 GDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHES 188

  Fly   141 SSINHFYGFYDECKRRY-TVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRR 204
            ..|...|||||||.|:| :..:|:.|.|.::..|:.|:::..|||.||||||.:.::.|:|::.|
Yeast   189 RQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPVTALVDNKIFCLHGGLSPMIETIDQVRDLNR 253

  Fly   205 PIEIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYE 269
            ..|:|..|.:||:||||||.| .|||.:.||...|||.|:...|.|...|:||.|.||:|.:||.
Yeast   254 IQEVPHEGPMCDLLWSDPDDR-GGWGISPRGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYS 317

  Fly   270 FFAKRQLITIFSAPNYCGEFDNAGAMMCINQD 301
            :..::.::|||||||||....|..|:|.::::
Yeast   318 WSHQQNVVTIFSAPNYCYRCGNQAAIMEVDEN 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 120/282 (43%)
MPP_superfamily 23..311 CDD:301300 119/281 (42%)
PPH22NP_010093.1 MPP_PP2A_PP4_PP6 78..360 CDD:277360 118/279 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.