DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and CNA1

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_013537.1 Gene:CNA1 / 851153 SGDID:S000004425 Length:553 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:103/282 - (36%)
Similarity:153/282 - (54%) Gaps:20/282 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYPPDSVYLLLGDY 106
            ::|..:...:.:.:...|.|:|.||::.|||.:.|||||||.:||:.||..|.|.:..||.||||
Yeast    84 RLSKEQAIKILNMSTVALSKEPNLLKLKAPITICGDIHGQYYDLLKLFEVGGDPAEIDYLFLGDY 148

  Fly   107 VDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTVKLWRTFVDCYNC 171
            ||||..|.|.|..|.:||.....:|::|||||||..:..::.|.:|...:|.::::......:|.
Yeast   149 VDRGAFSFECLIYLYSLKLNNLGRFWMLRGNHECKHLTSYFTFKNEMLHKYDMEVYDACCRSFNV 213

  Fly   172 LPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICDILWSDP-------------D 223
            |||||::....||.|||:||.|.|::.:.:|.|..|||..||:||:||:||             |
Yeast   214 LPLAALMNGQYFCVHGGISPELKSVEDVNKINRFREIPSRGLMCDLLWADPVENYDDARDGSEFD 278

  Fly   224 LRIMGWGPNE-RGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQ------LITIFS 281
            .....:.||. ||.|..|.......||....|..|.|.|:..:.||..:...:      |||:||
Yeast   279 QSEDEFVPNSLRGCSFAFTFKASCKFLKANGLLSIIRAHEAQDAGYRMYKNNKVTGFPSLITMFS 343

  Fly   282 APNYCGEFDNAGAMMCINQDLL 303
            ||||...:.|..|::...::::
Yeast   344 APNYLDTYHNKAAVLKYEENVM 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 103/282 (37%)
MPP_superfamily 23..311 CDD:301300 103/282 (37%)
CNA1NP_013537.1 MPP_PP2B 70..381 CDD:277361 103/282 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.