DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and BSU1

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_171844.6 Gene:BSU1 / 838804 AraportID:AT1G03445 Length:793 Species:Arabidopsis thaliana


Alignment Length:302 Identity:124/302 - (41%)
Similarity:180/302 - (59%) Gaps:29/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYPPDSV-------- 99
            :|..|::.:|....::.:.:||||::..||.:.|||||||.:|:|.|...|:|  ||        
plant   476 LSYLEVKHLCDEVEKIFMNEPTLLQLKVPIKVFGDIHGQYGDLMRLFHEYGHP--SVEGDITHID 538

  Fly   100 YLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRR----YTVK 160
            ||.||||||||:.|:|.:.||.|||..||...:|:|||||..::|..|||..||:.|    |..:
plant   539 YLFLGDYVDRGQHSLEIIMLLFALKIEYPKNIHLIRGNHESLAMNRIYGFLTECEERMGESYGFE 603

  Fly   161 LWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESG--LICDILWSDPD 223
            .|......::.|||||::|:.:.|.|||:. ...::::|..|.|| ..|::|  ::.|||||||.
plant   604 AWLKINQVFDYLPLAALLEKKVLCVHGGIG-RAVTIEEIENIERP-AFPDTGSMVLKDILWSDPT 666

  Fly   224 LR--IMGWGPNERG---VSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSAP 283
            :.  ::|...|.||   ||  ||.|:|.|||.|..|.:|.|.|:.|.||:|.||..:|||:|||.
plant   667 MNDTVLGIVDNARGEGVVS--FGPDIVKAFLERNGLEMILRAHECVIDGFERFADGRLITVFSAT 729

  Fly   284 NYCGEFDNAGAMMCINQDLLCTFRV----QRPILSEQRRLSD 321
            ||||...||||::.|.:|::...::    ..||.|.:...:|
plant   730 NYCGTAQNAGAILVIGRDMVIYPKLIHPHPPPISSSEEDYTD 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 120/290 (41%)
MPP_superfamily 23..311 CDD:301300 120/290 (41%)
BSU1NP_171844.6 PLN02193 <26..294 CDD:177844
KELCH repeat 31..92 CDD:276965
KELCH repeat 99..147 CDD:276965
KELCH repeat 202..249 CDD:276965
KELCH repeat 253..315 CDD:276965
MPP_superfamily 456..757 CDD:387346 120/286 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.