DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and TOPP2

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001032103.1 Gene:TOPP2 / 836034 AraportID:AT5G59160 Length:312 Species:Arabidopsis thaliana


Alignment Length:300 Identity:173/300 - (57%)
Similarity:225/300 - (75%) Gaps:21/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LDQIIAKL------------KLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLG 76
            ||.||.:|            .::.|         .||..:|..:||:.|:||.|||:.|||.:.|
plant    14 LDDIIRRLLDYRNPKPGTKQAMLNE---------SEIRQLCIVSREIFLQQPNLLELEAPIKICG 69

  Fly    77 DIHGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECS 141
            ||||||.:|||.||..|:||.:.||.|||||||||||:||:.||||.|.:||..|:||||||||:
plant    70 DIHGQYSDLLRLFEYGGFPPTANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECA 134

  Fly   142 SINHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPI 206
            |||..||||||||||::|:||:.|.|.:||||:||:|::.|.|.||||||.|.:::||:.|:||.
plant   135 SINRIYGFYDECKRRFSVRLWKVFTDSFNCLPVAAVIDDKILCMHGGLSPDLTNVEQIKNIKRPT 199

  Fly   207 EIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFF 271
            ::|:|||:||:|||||...:.|||.|:||||:|||.|.|:.||.:..::||||.|||||||||||
plant   200 DVPDSGLLCDLLWSDPSKDVKGWGMNDRGVSYTFGPDKVAEFLIKNDMDLICRAHQVVEDGYEFF 264

  Fly   272 AKRQLITIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRP 311
            |.|||:|||||||||||||||||||.:::.|:|:|::.:|
plant   265 ADRQLVTIFSAPNYCGEFDNAGAMMSVDESLMCSFQILKP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 172/298 (58%)
MPP_superfamily 23..311 CDD:301300 172/298 (58%)
TOPP2NP_001032103.1 MPP_PP1_PPKL 14..304 CDD:277359 172/298 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.