DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and TOPP6

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_851123.1 Gene:TOPP6 / 834356 AraportID:AT5G43380 Length:331 Species:Arabidopsis thaliana


Alignment Length:291 Identity:186/291 - (63%)
Similarity:236/291 - (81%) Gaps:2/291 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DEGINLDQIIAKLKLIGE-IGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQY 82
            |.| .|:.:|.:|....| .|.:||:|..||:.:|..:|::.|:||.|||:.||:.:.|||||||
plant     2 DPG-TLNSVINRLLEAREKPGKIVQLSETEIKQLCFVSRDIFLRQPNLLELEAPVKICGDIHGQY 65

  Fly    83 LNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFY 147
            .:|||.||..||||:|.||.|||||||||||:||:.||||.|.::|..|:|||||||.:|||..|
plant    66 PDLLRLFEHGGYPPNSNYLFLGDYVDRGKQSLETICLLLAYKIKFPENFFLLRGNHESASINRIY 130

  Fly   148 GFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESG 212
            |||||||||::||:||.|.||:||||:||:|:|.|||.||||||.|.|::|||:||||.:||:.|
plant   131 GFYDECKRRFSVKIWRIFTDCFNCLPVAALIDERIFCMHGGLSPELLSLRQIRDIRRPTDIPDRG 195

  Fly   213 LICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLI 277
            |:||:||||||..:.|||||:||||:|||||:||.||.|..|:||||.|||||||:||||.:||:
plant   196 LLCDLLWSDPDKDVRGWGPNDRGVSYTFGSDIVSGFLKRLDLDLICRAHQVVEDGFEFFANKQLV 260

  Fly   278 TIFSAPNYCGEFDNAGAMMCINQDLLCTFRV 308
            |||||||||||||||||||.:::||.|:|::
plant   261 TIFSAPNYCGEFDNAGAMMSVSEDLTCSFQI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 184/288 (64%)
MPP_superfamily 23..311 CDD:301300 184/287 (64%)
TOPP6NP_851123.1 PTZ00480 6..297 CDD:185658 184/286 (64%)
MPP_PP1_PPKL 6..293 CDD:277359 184/286 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.