DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and TOPP7

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_567375.1 Gene:TOPP7 / 826726 AraportID:AT4G11240 Length:322 Species:Arabidopsis thaliana


Alignment Length:302 Identity:181/302 - (59%)
Similarity:230/302 - (76%) Gaps:7/302 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DEGINLDQIIAKLKLIGEIGSVV---QISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHG 80
            ||.: ||.||.:| |....|..|   ||:..||..:|..::||.|.||.|||:.|||.:.||:||
plant     2 DETL-LDDIIRRL-LATNNGRTVKQAQITETEIRQLCLASKEVFLSQPNLLELEAPIKICGDVHG 64

  Fly    81 QYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINH 145
            |:.:|||.||..||||.:.||.||||||||||||||:.||||.|.:|...|:||||||||:|||.
plant    65 QFPDLLRLFEYGGYPPAANYLFLGDYVDRGKQSIETICLLLAYKVKYKFNFFLLRGNHECASINR 129

  Fly   146 FYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPE 210
            .|||||||||||.|:||:||.:|:||||::|:|::.|.|.||||||.:.|:..||.|.|||::|:
plant   130 VYGFYDECKRRYNVRLWKTFTECFNCLPVSALIDDKILCMHGGLSPDIKSLDDIRRIPRPIDVPD 194

  Fly   211 SGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQ 275
            .|::||:||:|||..|.|||.|:||||:|||:|.|:.||....|:||||.|||||||||||||||
plant   195 QGILCDLLWADPDREIQGWGENDRGVSYTFGADKVAEFLQTHDLDLICRAHQVVEDGYEFFAKRQ 259

  Fly   276 LITIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQR 317
            |:|||||||||||||||||:|.::..|.|:|::.:  .||::
plant   260 LVTIFSAPNYCGEFDNAGALMSVDDSLTCSFQILK--ASEKK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 177/291 (61%)
MPP_superfamily 23..311 CDD:301300 177/290 (61%)
TOPP7NP_567375.1 MPP_PP1_PPKL 6..294 CDD:277359 177/288 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.