DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and TOPP1

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_180501.1 Gene:TOPP1 / 817489 AraportID:AT2G29400 Length:318 Species:Arabidopsis thaliana


Alignment Length:298 Identity:179/298 - (60%)
Similarity:232/298 - (77%) Gaps:7/298 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LDQIIAKLKLIGEI----GSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLN 84
            ||.||.:|......    |..|.:|..||..:|:.::|:.|:||.|||:.|||.:.|||||||.:
plant    20 LDDIIRRLVEFRNTRPGSGKQVHLSEGEIRQLCAVSKEIFLQQPNLLELEAPIKICGDIHGQYSD 84

  Fly    85 LLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGF 149
            |||.||..|:||::.||.|||||||||||:||:.||||.|.:||..|:|||||||.:|||..|||
plant    85 LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHESASINRIYGF 149

  Fly   150 YDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLI 214
            |||||||:.|:||:.|.||:||||:||:|::.|.|.|||:||.|.|:.|||.|.||::||||||:
plant   150 YDECKRRFNVRLWKIFTDCFNCLPVAALIDDRILCMHGGISPELKSLDQIRNIARPMDIPESGLV 214

  Fly   215 CDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITI 279
            ||:|||||...: |||.|:||||:|||:|.|:.||.:..::||||.||||||||||||:|||:|:
plant   215 CDLLWSDPSGDV-GWGMNDRGVSYTFGADKVAEFLEKHDMDLICRAHQVVEDGYEFFAERQLVTV 278

  Fly   280 FSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQR 317
            |||||||||||||||||.|::.|:|:|::.:|  ||::
plant   279 FSAPNYCGEFDNAGAMMSIDESLMCSFQILKP--SEKK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 176/290 (61%)
MPP_superfamily 23..311 CDD:301300 176/290 (61%)
TOPP1NP_180501.1 MPP_PP1_PPKL 19..310 CDD:277359 176/290 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.