DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and ppp1cc

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_700468.5 Gene:ppp1cc / 571753 ZFINID:ZDB-GENE-030131-5877 Length:323 Species:Danio rerio


Alignment Length:299 Identity:187/299 - (62%)
Similarity:242/299 - (80%) Gaps:4/299 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 INLDQIIAKLKLI--GEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLN 84
            :|:|.||.:|..:  .:.|..||:...||..:|.::||:.|.||.|||:.||:.:.|||||||.:
Zfish     7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 71

  Fly    85 LLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGF 149
            |||.||..||||:|.||.|||||||||||:||:.||||.|.:||..|:||||||||:|||..|||
Zfish    72 LLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 136

  Fly   150 YDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLI 214
            ||||:|||.:|||:||.||:||||:|||::|.||||||||||.|.||:|||.|.||.::|:.||:
Zfish   137 YDECRRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201

  Fly   215 CDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITI 279
            ||:||||||..::|||.|:||||.|||::||:.|||:..|:||||.||||||||||||||||:|:
Zfish   202 CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   280 FSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQRR 318
            |||||||||||||||||.:::.|:|:|::.:|  :|:::
Zfish   267 FSAPNYCGEFDNAGAMMSVDETLMCSFQILKP--AEKKK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 185/290 (64%)
MPP_superfamily 23..311 CDD:301300 185/289 (64%)
ppp1ccXP_700468.5 PTZ00480 6..313 CDD:185658 187/299 (63%)
MPP_PP1_PPKL 8..298 CDD:277359 185/289 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.