DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and Ppp4c

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001347393.1 Gene:Ppp4c / 56420 MGIID:1891763 Length:307 Species:Mus musculus


Alignment Length:299 Identity:126/299 - (42%)
Similarity:188/299 - (62%) Gaps:14/299 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NLDQIIAKLK---LIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLN 84
            :||:.|.:|:   ||.|         .|::|:|::|||:|:::..:..:.:|:.:.||||||:.:
Mouse     6 DLDRQIEQLRRCELIKE---------SEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYD 61

  Fly    85 LLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGF 149
            |...|...|..|::.||.:||:||||..|:||..||||||.|||.:..|:|||||...|...|||
Mouse    62 LKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGF 126

  Fly   150 YDECKRRY-TVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGL 213
            ||||.|:| :|.:||...:.::.|.|:|||:..|||.||||||.:.::.|||.|.|..|:|..|.
Mouse   127 YDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGP 191

  Fly   214 ICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLIT 278
            :||:|||||: ...|||.:.||..:.||||||:.|.....:::|||.||:|.:||::.....::|
Mouse   192 MCDLLWSDPE-DTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLT 255

  Fly   279 IFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQR 317
            ::||||||....|..|::.:::.|...|.:......|.|
Mouse   256 VWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 124/291 (43%)
MPP_superfamily 23..311 CDD:301300 124/291 (43%)
Ppp4cNP_001347393.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 124/293 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.