DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and PPP6C

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001116827.1 Gene:PPP6C / 5537 HGNCID:9323 Length:342 Species:Homo sapiens


Alignment Length:249 Identity:109/249 - (43%)
Similarity:156/249 - (62%) Gaps:2/249 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 EAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQS 113
            |.:|....::||::..:..:..|:.:.||||||:.:|...|.:.|..||:.|:.:||:||||..|
Human    62 ERLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYS 126

  Fly   114 IETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRY-TVKLWRTFVDCYNCLPLAAI 177
            :||.|.||||||::|.:..|||||||...|...|||||||:.:| ....||.....::.|.:||:
Human   127 LETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAAL 191

  Fly   178 IEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGS 242
            |:|.|.|.||||||.:.::.|||.|.|..|||..|..||::||||: .:..|..:.||....||:
Human   192 IDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPE-DVDTWAISPRGAGWLFGA 255

  Fly   243 DVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMM 296
            .|.:.|:|...|.||||.||:|.:||:|....:|:|::||||||....|..::|
Human   256 KVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 109/249 (44%)
MPP_superfamily 23..311 CDD:301300 109/249 (44%)
PPP6CNP_001116827.1 MPP_PP2A_PP4_PP6 5..326 CDD:277360 109/249 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.