DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and PPP5C

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_016882424.1 Gene:PPP5C / 5536 HGNCID:9322 Length:551 Species:Homo sapiens


Alignment Length:244 Identity:103/244 - (42%)
Similarity:142/244 - (58%) Gaps:7/244 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RAREVLLKQPTLLEI----PAPINLLGDIHGQYLNLLRYFESNGYPPD-SVYLLLGDYVDRGKQS 113
            :.:|||.|..||:|.    ...|.:.||.|||:.:||..||.||.|.: :.|:..||:||||..|
Human   215 QVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFS 279

  Fly   114 IETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAII 178
            :|.:..|...|..||..|:|||||||..::|..|||..|.|.:||.:::..|.:.:..||||..|
Human   280 VEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCI 344

  Fly   179 EENIFCCHGGL-SPHLFSMQQIREIRRPIEIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGS 242
            ...:...|||| |....::..||:|.|..:.|:||.:||:|||||..: .|...::||||..||.
Human   345 NGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQ-NGRSISKRGVSCQFGP 408

  Fly   243 DVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDN 291
            ||..|||....|:.|.|.|:|..:|||.....:.:|:|||||||.:..|
Human   409 DVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGN 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 103/244 (42%)
MPP_superfamily 23..311 CDD:301300 103/244 (42%)
PPP5CXP_016882424.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.