DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and PPP2CB

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001009552.1 Gene:PPP2CB / 5516 HGNCID:9300 Length:309 Species:Homo sapiens


Alignment Length:284 Identity:124/284 - (43%)
Similarity:178/284 - (62%) Gaps:8/284 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LDQIIAKLKLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLRY 88
            |||.:.:|      ....|::..::..:|.:|:|:|.|:..:.|:..|:.:.||:|||:.:|:..
Human    10 LDQWVEQL------NECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMEL 68

  Fly    89 FESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDEC 153
            |...|..||:.||.:|||||||..|:||:|||:|||.|||.:..:||||||...|...|||||||
Human    69 FRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDEC 133

  Fly   154 KRRY-TVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICDI 217
            .|:| ...:|:.|.|.::.|||.|:::..|||.||||||.:.::..||.:.|..|:|..|.:||:
Human   134 LRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDL 198

  Fly   218 LWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSA 282
            ||||||.| .|||.:.||..:|||.|:...|.|...|.|:.|.||:|.:||.:...|.::|||||
Human   199 LWSDPDDR-GGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSA 262

  Fly   283 PNYCGEFDNAGAMMCINQDLLCTF 306
            ||||....|..|:|.::..|..:|
Human   263 PNYCYRCGNQAAIMELDDTLKYSF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 124/284 (44%)
MPP_superfamily 23..311 CDD:301300 124/284 (44%)
PPP2CBNP_001009552.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 124/284 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.