DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and PPP2CA

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_002706.1 Gene:PPP2CA / 5515 HGNCID:9299 Length:309 Species:Homo sapiens


Alignment Length:292 Identity:127/292 - (43%)
Similarity:182/292 - (62%) Gaps:11/292 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DEGI---NLDQIIAKLKLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHG 80
            ||.:   .|||.|.:|      ....|:|..:::::|.:|:|:|.|:..:.|:..|:.:.||:||
Human     2 DEKVFTKELDQWIEQL------NECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG 60

  Fly    81 QYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINH 145
            |:.:|:..|...|..||:.||.:|||||||..|:||:|||:|||.||..:..:||||||...|..
Human    61 QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQ 125

  Fly   146 FYGFYDECKRRY-TVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIP 209
            .|||||||.|:| ...:|:.|.|.::.|||.|:::..|||.||||||.:.::..||.:.|..|:|
Human   126 VYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVP 190

  Fly   210 ESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKR 274
            ..|.:||:||||||.| .|||.:.||..:|||.|:...|.|...|.|:.|.||:|.:||.:...|
Human   191 HEGPMCDLLWSDPDDR-GGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDR 254

  Fly   275 QLITIFSAPNYCGEFDNAGAMMCINQDLLCTF 306
            .::|||||||||....|..|:|.::..|..:|
Human   255 NVVTIFSAPNYCYRCGNQAAIMELDDTLKYSF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 125/289 (43%)
MPP_superfamily 23..311 CDD:301300 125/285 (44%)
PPP2CANP_002706.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 125/285 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.