DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and PPP1CB

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_002700.1 Gene:PPP1CB / 5500 HGNCID:9282 Length:327 Species:Homo sapiens


Alignment Length:304 Identity:187/304 - (61%)
Similarity:243/304 - (79%) Gaps:10/304 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DEGINLDQIIAKLKLIGEI-----GSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDI 78
            |..:|:|.:|.:|.   |:     |.:||::..|:..:|.::||:.|.||.|||:.||:.:.|||
Human     3 DGELNVDSLITRLL---EVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDI 64

  Fly    79 HGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSI 143
            ||||.:|||.||..|:||::.||.|||||||||||:||:.||||.|.:||..|:||||||||:||
Human    65 HGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASI 129

  Fly   144 NHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEI 208
            |..||||||||||:.:|||:||.||:||||:|||::|.||||||||||.|.||:|||.|.||.::
Human   130 NRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDV 194

  Fly   209 PESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAK 273
            |::||:||:||||||..:.|||.|:||||.|||:||||.||:|..|:||||.|||||||||||||
Human   195 PDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAK 259

  Fly   274 RQLITIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQR 317
            |||:|:||||||||||||||.||.:::.|:|:|::.:|  ||::
Human   260 RQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKP--SEKK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 183/293 (62%)
MPP_superfamily 23..311 CDD:301300 183/292 (63%)
PPP1CBNP_002700.1 MPP_PP1_PPKL 7..297 CDD:277359 183/292 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158258
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.