DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and PPP1CA

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001008709.1 Gene:PPP1CA / 5499 HGNCID:9281 Length:341 Species:Homo sapiens


Alignment Length:305 Identity:188/305 - (61%)
Similarity:237/305 - (77%) Gaps:13/305 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGINLDQIIAKLKLIGEI-------------GSVVQISVREIEAVCSRAREVLLKQPTLLEIPAP 71
            |.:|||.||.:|.....:             |..||::..||..:|.::||:.|.||.|||:.||
Human     5 EKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAP 69

  Fly    72 INLLGDIHGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRG 136
            :.:.|||||||.:|||.||..|:||:|.||.|||||||||||:||:.||||.|.:||..|:||||
Human    70 LKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRG 134

  Fly   137 NHECSSINHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIRE 201
            ||||:|||..|||||||||||.:|||:||.||:||||:|||::|.||||||||||.|.||:|||.
Human   135 NHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRR 199

  Fly   202 IRRPIEIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVED 266
            |.||.::|:.||:||:||||||..:.|||.|:||||.|||::||:.|||:..|:||||.||||||
Human   200 IMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVED 264

  Fly   267 GYEFFAKRQLITIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRP 311
            ||||||||||:|:|||||||||||||||||.:::.|:|:|::.:|
Human   265 GYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 186/301 (62%)
MPP_superfamily 23..311 CDD:301300 186/300 (62%)
PPP1CANP_001008709.1 PTZ00480 6..319 CDD:185658 187/304 (62%)
MPP_PP1_PPKL 8..309 CDD:277359 186/300 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.