DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and PPEF1

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001364915.1 Gene:PPEF1 / 5475 HGNCID:9243 Length:653 Species:Homo sapiens


Alignment Length:296 Identity:90/296 - (30%)
Similarity:132/296 - (44%) Gaps:53/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VCSRAREVLLKQPTLLEIPA----PINLLGDIHGQYLNLLRYFESNGYPPD-SVYLLLGDYVDRG 110
            |....::||.:.|....|..    .:.:.||:||:..:|...|..||.|.: :.|:..||:||||
Human   142 VLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRG 206

  Fly   111 KQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTV---KLWRTFVDCYNCL 172
            |.|||.|.:|......||...:|.|||||...:|..|||..|...:|.:   ::.:...:.|..|
Human   207 KNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWL 271

  Fly   173 PLAAIIEENIFCCHGGLSP-------HLFSMQQIREIRRPI------------------------ 206
            |:..|::..|...|||:|.       |.....:::.:..|.                        
Human   272 PIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHG 336

  Fly   207 EIPESG------------LICDILWSDPDLRIMGWGPNE-RGVSHTFGSDVVSAFLHRFKLNLIC 258
            .|..:|            .|.|||||||..: .|..||. ||....||.||.|..|::::|.::.
Human   337 RIKTNGSPTEHLTEHEWEQIIDILWSDPRGK-NGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLI 400

  Fly   259 RGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGA 294
            |.|:...:|||.....:::|||||.||..|..|.||
Human   401 RSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGA 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 90/296 (30%)
MPP_superfamily 23..311 CDD:301300 90/296 (30%)
PPEF1NP_001364915.1 IQ 18..37 CDD:197470
MPP_RdgC 115..452 CDD:277364 90/296 (30%)
Catalytic 121..455 90/296 (30%)
EF-hand_7 568..636 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.