DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and ppp2cb

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001005443.1 Gene:ppp2cb / 448031 XenbaseID:XB-GENE-957248 Length:309 Species:Xenopus tropicalis


Alignment Length:284 Identity:124/284 - (43%)
Similarity:178/284 - (62%) Gaps:8/284 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LDQIIAKLKLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLRY 88
            |||.|.:|      ....|::..::..:|.:|:|:|.|:..:.::..|:.:.||:|||:.:|:..
 Frog    10 LDQWIEQL------NDCKQLNESQVRTLCEKAKEILTKESNVQDVRCPVTVCGDVHGQFHDLMEL 68

  Fly    89 FESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDEC 153
            |...|..||:.||.:|||||||..|:||:|||:|||.|||.:..:||||||...|...|||||||
 Frog    69 FRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDEC 133

  Fly   154 KRRY-TVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICDI 217
            .|:| ...:|:.|.|.::.|||.|:::..|||.||||||.:.::..||.:.|..|:|..|.:||:
 Frog   134 LRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDL 198

  Fly   218 LWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSA 282
            ||||||.| .|||.:.||..:|||.|:...|.|...|.|:.|.||:|.:||.:...|.::|||||
 Frog   199 LWSDPDDR-GGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSA 262

  Fly   283 PNYCGEFDNAGAMMCINQDLLCTF 306
            ||||....|..|:|.::..|..:|
 Frog   263 PNYCYRCGNQAAIMELDDTLKYSF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 124/284 (44%)
MPP_superfamily 23..311 CDD:301300 124/284 (44%)
ppp2cbNP_001005443.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 124/284 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.