DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and ppp4c

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_988943.1 Gene:ppp4c / 394540 XenbaseID:XB-GENE-970535 Length:307 Species:Xenopus tropicalis


Alignment Length:299 Identity:126/299 - (42%)
Similarity:188/299 - (62%) Gaps:14/299 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NLDQIIAKLK---LIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLN 84
            :||:.|.:|:   ||.|         .|::|:|::|||:|:::..:..:.:|:.:.||||||:.:
 Frog     6 DLDRQIEQLRRCELIKE---------SEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYD 61

  Fly    85 LLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGF 149
            |...|...|..|::.||.:||:||||..|:||..||||||.|||.:..|:|||||...|...|||
 Frog    62 LKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGF 126

  Fly   150 YDECKRRY-TVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGL 213
            ||||.|:| :|.:||...:.::.|.|:|||:..|||.||||||.:.::.|||.|.|..|:|..|.
 Frog   127 YDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGP 191

  Fly   214 ICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLIT 278
            :||:|||||: ...|||.:.||..:.||||||:.|.....:::|||.||:|.:||::.....::|
 Frog   192 MCDLLWSDPE-DTTGWGVSPRGAGYLFGSDVVAQFNAANNIDMICRAHQLVMEGYKWHFNETVLT 255

  Fly   279 IFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQR 317
            ::||||||....|..|::.:::.|...|.:......|.|
 Frog   256 VWSAPNYCYRCGNVAAILELDEHLQKEFIIFEAAPQETR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 124/291 (43%)
MPP_superfamily 23..311 CDD:301300 124/291 (43%)
ppp4cNP_988943.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 124/293 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.