DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and Y71G12B.30

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 / 3565302 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans


Alignment Length:266 Identity:131/266 - (49%)
Similarity:175/266 - (65%) Gaps:6/266 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 REIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYP------PDSVYLLLG 104
            :||..:|.||||...|:|..|||.||:.:.||||||:.:||..|:..|:|      ..|.||.||
 Worm    39 KEIIEICYRAREAFWKEPMKLEIEAPVTICGDIHGQFEDLLSMFDIYGFPHVSQKDKSSRYLFLG 103

  Fly   105 DYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTVKLWRTFVDCY 169
            ||:|||..|||.:|||.|.:..:|.|.:|||||||...:|..||||:||||||:|.|:.||...:
 Worm   104 DYIDRGPFSIEVITLLFAYRLLHPQKMFLLRGNHESRPVNMQYGFYNECKRRYSVTLYETFQWAF 168

  Fly   170 NCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICDILWSDPDLRIMGWGPNER 234
            .|:||.||:...|.|.|||:...|.|::||.|.:||.:|.:.|:..|:.|:||...::|:..:.|
 Worm   169 YCMPLCAIVGGRIMCMHGGIPFGLLSLEQIDEFQRPTDIADVGIPSDLCWADPVSGVVGFQDSPR 233

  Fly   235 GVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMCIN 299
            |..|.||...|..|..:|||:||.|.||||.|||||||.::|:||||||.|||.|||.||::.:.
 Worm   234 GAGHVFGEATVKEFNEKFKLDLIVRAHQVVMDGYEFFADKKLVTIFSAPCYCGHFDNLGAVLQVA 298

  Fly   300 QDLLCT 305
            .::.||
 Worm   299 TNMECT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 131/266 (49%)
MPP_superfamily 23..311 CDD:301300 131/266 (49%)
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 131/266 (49%)
MPP_superfamily 36..304 CDD:301300 129/264 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.