DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and Ppef1

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_038955765.1 Gene:Ppef1 / 317498 RGDID:1562772 Length:664 Species:Rattus norvegicus


Alignment Length:285 Identity:98/285 - (34%)
Similarity:139/285 - (48%) Gaps:42/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VCSRAREVLLKQPTLLEI---PA-PINLLGDIHGQYLNLLRYFESNGYPPD-SVYLLLGDYVDRG 110
            |...||::|.:.|....|   || .|.:.||:||:..:|:..|..||.|.: :.|:..||:||||
  Rat   167 VLFEARKILKQMPNFTRIQTFPAKEITICGDLHGKLDDLMLIFYKNGLPSEKNPYVFNGDFVDRG 231

  Fly   111 KQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTV---KLWRTFVDCYNCL 172
            ..|:|.|.:||.....|||..:|.|||||...:|..|||..|..::|.:   |:.:...:.|..|
  Rat   232 NNSMEILMILLVSFLVYPTDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGKKILQVLEELYTWL 296

  Fly   173 PLAAIIEENIFCCHGGL--SPHLFSMQQI-REIRRPIEIP------------------------- 209
            |:..||:..|...|||:  |..|..:||: |...:.:.:|                         
  Rat   297 PIGTIIDNEILVIHGGISESTDLNILQQLQRNKMKSVLMPPMSTNQECNIKKNKAGPSEQSASEQ 361

  Fly   210 ----ESGLICDILWSDPDLRIMGWGPN-ERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYE 269
                |...|.|:|||||..: .|..|| .||....||.||.|..|::.:|.::.|.|:...||||
  Rat   362 LTKLEWEQIIDLLWSDPRGK-KGCYPNTSRGGGCYFGPDVTSKVLNKNQLKMVIRSHECKPDGYE 425

  Fly   270 FFAKRQLITIFSAPNYCGEFDNAGA 294
            .....::||:|||.||..|..|.||
  Rat   426 ICHDGKVITVFSASNYYEEGSNRGA 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 98/285 (34%)
MPP_superfamily 23..311 CDD:301300 98/285 (34%)
Ppef1XP_038955765.1 IQ 40..>57 CDD:197470
MPP_RdgC 140..466 CDD:277364 98/285 (34%)
PTZ00183 505..647 CDD:185503
EF-hand_7 582..650 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.