DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and PpV

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster


Alignment Length:267 Identity:110/267 - (41%)
Similarity:162/267 - (60%) Gaps:4/267 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYPP 96
            |.|.::.....:...|::.:|....::||::..:|.:..|:.:.||||||:.:|.:.|.:.|..|
  Fly     6 KWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVP 70

  Fly    97 DSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRY-TVK 160
            .:.|:.:||:||||..|:||.|.||.||||||::..|||||||...|...|||:|||..:| ...
  Fly    71 HTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNAN 135

  Fly   161 LWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICDILWSDP-DL 224
            .|:.....::.|.:||||:|.:.|.||||||.:.::.|||.|.|..|||..|..||::|||| |:
  Fly   136 GWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPEDM 200

  Fly   225 RIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEF 289
            ..  ||.:.||....||.:|...|:....||||||.||:|.:|.::....:|:|::||||||...
  Fly   201 EY--WGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRC 263

  Fly   290 DNAGAMM 296
            .|..|::
  Fly   264 GNVAAIL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 110/267 (41%)
MPP_superfamily 23..311 CDD:301300 110/267 (41%)
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 110/267 (41%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 110/267 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438880
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.