DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and Ppp1cc

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001257912.1 Gene:Ppp1cc / 24669 RGDID:3377 Length:337 Species:Rattus norvegicus


Alignment Length:299 Identity:187/299 - (62%)
Similarity:242/299 - (80%) Gaps:4/299 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 INLDQIIAKLKLI--GEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLN 84
            :|:|.||.:|..:  .:.|..||:...||..:|.::||:.|.||.|||:.||:.:.|||||||.:
  Rat     7 LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYD 71

  Fly    85 LLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGF 149
            |||.||..|:||:|.||.|||||||||||:||:.||||.|.:||..|:||||||||:|||..|||
  Rat    72 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGF 136

  Fly   150 YDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLI 214
            ||||||||.:|||:||.||:||||:|||::|.||||||||||.|.||:|||.|.||.::|:.||:
  Rat   137 YDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL 201

  Fly   215 CDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITI 279
            ||:||||||..::|||.|:||||.|||::||:.|||:..|:||||.||||||||||||||||:|:
  Rat   202 CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTL 266

  Fly   280 FSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQRR 318
            |||||||||||||||||.:::.|:|:|::.:|  :|:::
  Rat   267 FSAPNYCGEFDNAGAMMSVDETLMCSFQILKP--AEKKK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 185/290 (64%)
MPP_superfamily 23..311 CDD:301300 185/289 (64%)
Ppp1ccNP_001257912.1 MPP_PP1_PPKL 8..298 CDD:277359 185/289 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.