DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and Ppp1ca

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_113715.1 Gene:Ppp1ca / 24668 RGDID:3375 Length:330 Species:Rattus norvegicus


Alignment Length:294 Identity:188/294 - (63%)
Similarity:237/294 - (80%) Gaps:2/294 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGINLDQIIAKLKLI--GEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQY 82
            |.:|||.||.:|..:  ...|..||::..||..:|.::||:.|.||.|||:.||:.:.|||||||
  Rat     5 EKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY 69

  Fly    83 LNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFY 147
            .:|||.||..|:||:|.||.|||||||||||:||:.||||.|.:||..|:||||||||:|||..|
  Rat    70 YDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIY 134

  Fly   148 GFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESG 212
            ||||||||||.:|||:||.||:||||:|||::|.||||||||||.|.||:|||.|.||.::|:.|
  Rat   135 GFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQG 199

  Fly   213 LICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLI 277
            |:||:||||||..:.|||.|:||||.|||::||:.|||:..|:||||.||||||||||||||||:
  Rat   200 LLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLV 264

  Fly   278 TIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRP 311
            |:|||||||||||||||||.:::.|:|:|::.:|
  Rat   265 TLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 186/290 (64%)
MPP_superfamily 23..311 CDD:301300 186/289 (64%)
Ppp1caNP_113715.1 MPP_PP1_PPKL 8..298 CDD:277359 186/289 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.