DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and Ppp3cb

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_006518770.1 Gene:Ppp3cb / 19056 MGIID:107163 Length:534 Species:Mus musculus


Alignment Length:302 Identity:111/302 - (36%)
Similarity:168/302 - (55%) Gaps:29/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LKFDEGINLDQI----IAKLKLIGEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLG 76
            |..:|..::|.|    :.|..|:.|.....:|::|    :.:....:|.::.|::|:.|||.:.|
Mouse    38 LTSEEVFDMDGIPRVDVLKNHLVKEGRVDEEIALR----IINEGAAILRREKTMIEVEAPITVCG 98

  Fly    77 DIHGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECS 141
            |||||:.:|::.||..|.|.::.||.||||||||..|||.:..|..||..||:..:||||||||.
Mouse    99 DIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECR 163

  Fly   142 SINHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPI 206
            .:..::.|..|||.:|:.:::...::.::.|||||::.:...|.||||||.:.::..||.:.|..
Mouse   164 HLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFK 228

  Fly   207 EIPESGLICDILWSDPDLRIMGWGPNE-----------RGVSHTFGSDVVSAFLHRFKLNLICRG 260
            |.|..|.:||:|||||.   ..:| ||           ||.|:.:....|..||....|..|.|.
Mouse   229 EPPAFGPMCDLLWSDPS---EDFG-NEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRA 289

  Fly   261 HQVVEDGYEFFAKRQ------LITIFSAPNYCGEFDNAGAMM 296
            |:..:.||..:.|.|      ||||||||||...::|..|::
Mouse   290 HEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 109/296 (37%)
MPP_superfamily 23..311 CDD:301300 109/295 (37%)
Ppp3cbXP_006518770.1 MPP_PP2B 50..354 CDD:277361 107/290 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.