DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and Ppp1cb

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_766295.2 Gene:Ppp1cb / 19046 MGIID:104871 Length:327 Species:Mus musculus


Alignment Length:304 Identity:187/304 - (61%)
Similarity:243/304 - (79%) Gaps:10/304 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DEGINLDQIIAKLKLIGEI-----GSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDI 78
            |..:|:|.:|.:|.   |:     |.:||::..|:..:|.::||:.|.||.|||:.||:.:.|||
Mouse     3 DGELNVDSLITRLL---EVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDI 64

  Fly    79 HGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSI 143
            ||||.:|||.||..|:||::.||.|||||||||||:||:.||||.|.:||..|:||||||||:||
Mouse    65 HGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASI 129

  Fly   144 NHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEI 208
            |..||||||||||:.:|||:||.||:||||:|||::|.||||||||||.|.||:|||.|.||.::
Mouse   130 NRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDV 194

  Fly   209 PESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAK 273
            |::||:||:||||||..:.|||.|:||||.|||:||||.||:|..|:||||.|||||||||||||
Mouse   195 PDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAK 259

  Fly   274 RQLITIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQR 317
            |||:|:||||||||||||||.||.:::.|:|:|::.:|  ||::
Mouse   260 RQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKP--SEKK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 183/293 (62%)
MPP_superfamily 23..311 CDD:301300 183/292 (63%)
Ppp1cbNP_766295.2 MPP_PP1_PPKL 7..297 CDD:277359 183/292 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848656
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.