DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and Ppp1ca

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_114074.1 Gene:Ppp1ca / 19045 MGIID:103016 Length:330 Species:Mus musculus


Alignment Length:294 Identity:189/294 - (64%)
Similarity:237/294 - (80%) Gaps:2/294 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGINLDQIIAKLKLI--GEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQY 82
            |.:|||.||.:|..:  ...|..||::..||..:|.::||:.|.||.|||:.||:.:.|||||||
Mouse     5 EKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY 69

  Fly    83 LNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFY 147
            .:|||.||..|:||:|.||.|||||||||||:||:.||||.|.|||..|:||||||||:|||..|
Mouse    70 YDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIY 134

  Fly   148 GFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESG 212
            ||||||||||.:|||:||.||:||||:|||::|.||||||||||.|.||:|||.|.||.::|:.|
Mouse   135 GFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQG 199

  Fly   213 LICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLI 277
            |:||:||||||..:.|||.|:||||.|||::||:.|||:..|:||||.||||||||||||||||:
Mouse   200 LLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLV 264

  Fly   278 TIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRP 311
            |:|||||||||||||||||.:::.|:|:|::.:|
Mouse   265 TLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 187/290 (64%)
MPP_superfamily 23..311 CDD:301300 187/289 (65%)
Ppp1caNP_114074.1 PTZ00480 6..308 CDD:185658 188/293 (64%)
MPP_PP1_PPKL 8..298 CDD:277359 187/289 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.