DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and Ppef2

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_030110066.1 Gene:Ppef2 / 19023 MGIID:1342304 Length:797 Species:Mus musculus


Alignment Length:387 Identity:98/387 - (25%)
Similarity:145/387 - (37%) Gaps:135/387 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QISVREIEAVCSRAREVLLKQPTLLEIPA----PINLLGDIHGQYLNLLRYFESNGYP-PDSVYL 101
            |:..|.:..:....|:.|.:.|.:..:..    .:.:.||:|||..:|:..|..||.| |:..|:
Mouse   180 QLHARYVLNLLYETRKHLAQLPNINRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPSPERAYV 244

  Fly   102 LLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTV---KLWR 163
            ..||:|||||.|:|.|.:|.|....||.:|:|.|||||...:|..|||..|...:|.:   |:.|
Mouse   245 FNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIHGKKILR 309

  Fly   164 TFVDCYNCLPLAAIIEENIFCCHGGL--------------------------------------- 189
            |..|.:..||||.:::|.:...|||:                                       
Mouse   310 TLQDVFCWLPLATLVDEKVLVLHGGVSDKTDLELLAKLDRHKIVSTMRCKTRKESENREEQKRKD 374

  Fly   190 ---------------------------------------------SPHLFSMQQIREIRRPIE-- 207
                                                         ||:...:.:..::||.::  
Mouse   375 NQTSSGQKPTPWFLPQSRSLPSSPFHLGSGFKAYKAGRSCSIPCGSPNSKELSRRGQVRRSVDLE 439

  Fly   208 ------------IPESG---------------------------LICDILWSDPDLRIMGWGPNE 233
                        |.|.|                           .:.|||||||..: .|...|.
Mouse   440 LEQCRQQAGFLGIREKGESLPLAPDADCVADGGGVLEPTPEEWKQVVDILWSDPAAQ-EGCKANA 503

  Fly   234 -RGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGA 294
             ||....||.||....:.::||.|:.|.|:...:||||...|:::|||||.||.....|.||
Mouse   504 VRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGA 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 98/387 (25%)
MPP_superfamily 23..311 CDD:301300 98/387 (25%)
Ppef2XP_030110066.1 IQ 61..80 CDD:197470
MPP_RdgC 162..581 CDD:277364 98/387 (25%)
FRQ1 621..765 CDD:227455
EFh 701..766 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.