DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and Y40H4A.2

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_506609.2 Gene:Y40H4A.2 / 189799 WormBaseID:WBGene00012741 Length:333 Species:Caenorhabditis elegans


Alignment Length:283 Identity:106/283 - (37%)
Similarity:163/283 - (57%) Gaps:12/283 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VQISVREIEAVCSRAREVLLKQPTLLEIP---APINLLGDIHGQYLNLLRYFESNGYPPDSVYLL 102
            |.:|..||..:.:.|........||:.:.   .|::::||:||.:.:|.|.|..:|.|..|.|:.
 Worm    46 VTVSKEEIRIISNYAAASFGSFSTLMRVDEDCLPVHIVGDLHGHFGDLRRIFGIHGAPGISHYVF 110

  Fly   103 LGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTVK---LWRT 164
            ||||||||:|.|||:.||:|....||...:|.|||||..:....|||:|||:.:|..|   .|..
 Worm   111 LGDYVDRGRQGIETVMLLMAYHCLYPDHLFLCRGNHEDYNTTMTYGFFDECRMKYGKKGTLAWLH 175

  Fly   165 FVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICDILWSDPD-LRIMG 228
            .::.:|.|||||:|.:.:.|.|||:|||:..::.|.:|:||..||..||.||::||||: ...:|
 Worm   176 IINAFNHLPLAALILDKVLCMHGGISPHIQKLEDIDKIQRPTFIPSYGLACDLVWSDPEKTSNVG 240

  Fly   229 WGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQV----VEDGYEFFAKRQLITIFSAPNYCGEF 289
            |..:.||:|.:|....:..|.....|:||.|.||:    :..|:::.|..:::|||||.||. ..
 Worm   241 WSLSARGISFSFDDITIEKFCQDNGLDLIVRAHQISSEMIRGGHKWHANGRMVTIFSAANYL-SM 304

  Fly   290 DNAGAMMCINQDLLCTFRVQRPI 312
            .|...::.|::.....|.:.||:
 Worm   305 GNDSCVIRIDEQKTMQFCLLRPV 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 104/280 (37%)
MPP_superfamily 23..311 CDD:301300 104/280 (37%)
Y40H4A.2NP_506609.2 PP2Ac 49..328 CDD:197547 105/280 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.