DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and T25B9.2

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_501992.2 Gene:T25B9.2 / 188880 WormBaseID:WBGene00012008 Length:343 Species:Caenorhabditis elegans


Alignment Length:326 Identity:133/326 - (40%)
Similarity:179/326 - (54%) Gaps:54/326 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYP---------------- 95
            |:..:|.||||::..:|..|::.|||.::||||||:.:||...:.||:|                
 Worm     8 ELAELCHRARELIWSEPIFLKLEAPICVMGDIHGQFDDLLAMLDMNGWPLSSQEFEALKDITVRS 72

  Fly    96 ----------------------------PDSV----------YLLLGDYVDRGKQSIETLTLLLA 122
                                        |.||          ||.||||||||..|:|.:.||.|
 Worm    73 RETGKRPQSEPHSTQPESSNDVKPPVAAPKSVNKEVTTGYKRYLFLGDYVDRGPFSMEVVILLTA 137

  Fly   123 LKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHG 187
            ||..||.:.||||||||..|:|..||||.|...||..:|:..|.:.:|..|..|:|...|.|.||
 Worm   138 LKLAYPDRIYLLRGNHESRSVNTSYGFYREVNYRYDAQLYECFQNMFNVFPFCAVINNTIMCMHG 202

  Fly   188 GLSPHLFSMQQIREIRRPIEIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRF 252
            |:|.||.|..|....:||:|||:.|::.|:.|:|||....|:.|:.||.|..||...:.|||.:.
 Worm   203 GISEHLTSFNQFSVFKRPLEIPDVGVLTDLTWADPDPTEKGYKPSARGASFVFGPPALRAFLKKL 267

  Fly   253 KLNLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQR 317
            .|.::.|||||||||||||..|:|:||||||||||:.||..|:..|::.|..:..|.||...:::
 Worm   268 DLQMVIRGHQVVEDGYEFFDGRRLVTIFSAPNYCGQNDNTAAVFSIDKKLKISINVFRPESRDKK 332

  Fly   318 R 318
            |
 Worm   333 R 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 130/317 (41%)
MPP_superfamily 23..311 CDD:301300 130/317 (41%)
T25B9.2NP_501992.2 PP2Ac 4..328 CDD:197547 132/319 (41%)
MPP_superfamily 7..326 CDD:301300 130/317 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.