DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and F44B9.9

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001367454.1 Gene:F44B9.9 / 185726 WormBaseID:WBGene00018410 Length:254 Species:Caenorhabditis elegans


Alignment Length:264 Identity:77/264 - (29%)
Similarity:119/264 - (45%) Gaps:74/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYPPDS----VY---- 100
            |..|:..:.....|:..|:.||.||..|:.::||||||:.:|:|...:.....::    :|    
 Worm     5 SKTELFCLLDMVIELFKKEKTLAEISPPVTIVGDIHGQFEDLVRLLNTRNSSENAKSKPIYGFST 69

  Fly   101 ---LLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRYTVKLW 162
               :.||||||||.:|::.:.|:.:||..:|.::.|||||||..:||..|||             
 Worm    70 KKWVFLGDYVDRGYKSLDCICLVFSLKICFPKQYILLRGNHETRAINFRYGF------------- 121

  Fly   163 RTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESGLICDILWSDPDLRIM 227
                                         .:.|:..::...:|..|..                 
 Worm   122 -----------------------------RVCSVVVLKIPAKPSFIRN----------------- 140

  Fly   228 GWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNA 292
                |:||:|..|....|:.......::||.||||::..|::|||.|:|.||||||.|..|.||:
 Worm   141 ----NKRGLSVCFNEAAVNETCRLLNISLIVRGHQMMPAGFKFFADRKLCTIFSAPRYMNEIDNS 201

  Fly   293 GAMM 296
            ||:|
 Worm   202 GAVM 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 77/264 (29%)
MPP_superfamily 23..311 CDD:301300 77/264 (29%)
F44B9.9NP_001367454.1 MPP_superfamily 4..219 CDD:417454 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.