DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and gsp-1

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001256250.1 Gene:gsp-1 / 179486 WormBaseID:WBGene00001747 Length:329 Species:Caenorhabditis elegans


Alignment Length:304 Identity:186/304 - (61%)
Similarity:242/304 - (79%) Gaps:10/304 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DEGINLDQIIAKLKLIGEI-----GSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDI 78
            |..:|:|.:|.:|.   |:     |..|.:|..||.|:|.::||:.|.||.|||:.||:.:.|||
 Worm     4 DGDLNIDNLITRLL---EVRGCRPGKPVTMSEAEIRALCHKSREIFLSQPILLELEAPLKICGDI 65

  Fly    79 HGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSI 143
            ||||.:|||.||..|:||::.||.|||||||||||:||:.||||.|.:||..|:||||||||:||
 Worm    66 HGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASI 130

  Fly   144 NHFYGFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEI 208
            |..||||||||||:::|||:||.||:||||:||:|:|.||||||||||.|.:|:|||.:.||.::
 Worm   131 NRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDLQNMEQIRRVMRPTDV 195

  Fly   209 PESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAK 273
            |::||:||:||||||..:.|||.|:||||.|||.|||:.||:|..|:||||.|||||||||||||
 Worm   196 PDTGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPDVVAKFLNRHDLDLICRAHQVVEDGYEFFAK 260

  Fly   274 RQLITIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQR 317
            |||:|:||||||||||||||.||.:::.|:|:|::.:|  ||::
 Worm   261 RQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKP--SEKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 182/293 (62%)
MPP_superfamily 23..311 CDD:301300 182/292 (62%)
gsp-1NP_001256250.1 MPP_PP1_PPKL 8..298 CDD:277359 182/292 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165955
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.