DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpN58A and C47A4.3

DIOPT Version :9

Sequence 1:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_502650.1 Gene:C47A4.3 / 178340 WormBaseID:WBGene00008124 Length:316 Species:Caenorhabditis elegans


Alignment Length:258 Identity:132/258 - (51%)
Similarity:178/258 - (68%) Gaps:5/258 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VLLKQPTLLEIPAPINLLGDIHGQYLNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLA 122
            |...|..::|:.|||.:.||||||:.:|||.|...|:||.:.||.||||||||:.||||:.||||
 Worm    42 VFKAQKPMVEVNAPIKVCGDIHGQFPDLLRLFHRGGWPPTANYLFLGDYVDRGRFSIETIVLLLA 106

  Fly   123 LKARYPTKFYLLRGNHECSSINHFYGFYDECKRRY-TVKLWRTFVDCYNCLPLAAIIEENIFCCH 186
            .|.::|..|:||||||||..:|..||||:||::|| :|:::..|.|.:|.|||..:|...|.|.|
 Worm   107 YKVKFPCNFFLLRGNHECEFVNKTYGFYEECQKRYQSVRMYAAFQDVFNWLPLTGLIATKILCMH 171

  Fly   187 GGLSPHL---FSMQQIREIRRPIEIPESGLICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAF 248
            |||||.:   |::..:|:|.||.|..| ||:.|:||:||...:.|:..|:||....||.|.|...
 Worm   172 GGLSPLMTKEFTLDTLRKIERPTEGKE-GLVADLLWADPISGLSGFMNNQRGAGCGFGRDSVLNL 235

  Fly   249 LHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRP 311
            ...|:|:|:||.||||:|||||||.|:|:||||||:|||:|||..|.|..::.|.|:|.:.||
 Worm   236 CSEFQLDLVCRAHQVVQDGYEFFAGRKLVTIFSAPHYCGQFDNCAAFMSCDEKLQCSFEILRP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 130/256 (51%)
MPP_superfamily 23..311 CDD:301300 130/256 (51%)
C47A4.3NP_502650.1 MPP_superfamily 5..298 CDD:301300 130/256 (51%)
PP2Ac 27..299 CDD:197547 132/258 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.